PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400023878
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NF-YB
Protein Properties Length: 155aa    MW: 16901.4 Da    PI: 4.3887
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400023878genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB30.68.3e-1032725595
                 NF-YB 55 qrekrktingddllwalatlGfedyveplkvylkkyreleg 95
                           re+r+t + +d+ w + ++Gf+dy+epl +y+ + re +g
  PGSC0003DMP400023878 32 LREQRNTNTDEDVHWVINKFGFDDYIEPLPLYFPRCREDDG 72
                          59**********************************99665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.0E-52773IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MDNGNHVGGS GNGGFHSYRK SPQLTPAHSL PLREQRNTNT DEDVHWVINK FGFDDYIEPL  60
PLYFPRCRED DGGECGSLIG ESLLKRPMVD TSSSCNITPY HLPPNFPMAH HHFVYPPPVG  120
NGDMQGDASN GSTSQCEVAS VDSDVEAPTE EDNE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-119HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015168348.11e-105PREDICTED: nuclear transcription factor Y subunit B-6-like
TrEMBLM1B1U71e-113M1B1U7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000351211e-112(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.24e-13nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]